PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G0516
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 219aa    MW: 25369.6 Da    PI: 7.7141
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G0516genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding612.5e-191360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd+ll+d+vk +G+g+W++Ia++ g++R++k+c++rw +yl
      Gh_D04G0516 13 KGLWTMEEDKLLIDYVKVHGKGQWNKIANRTGLKRSGKSCRLRWMNYL 60
                     678*******************************************97 PP

2Myb_DNA-binding59.67.1e-1966111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g +++eE++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
      Gh_D04G0516  66 KGDFSEEEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNSHL 111
                      689*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.04160IPR017930Myb domain
SuperFamilySSF466893.52E-3112107IPR009057Homeodomain-like
SMARTSM007173.6E-151262IPR001005SANT/Myb domain
PfamPF002496.2E-181360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-231467IPR009057Homeodomain-like
CDDcd001673.23E-121660No hitNo description
PROSITE profilePS5129428.94561115IPR017930Myb domain
SMARTSM007176.6E-1965113IPR001005SANT/Myb domain
PfamPF002494.8E-1866111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2768115IPR009057Homeodomain-like
CDDcd001673.43E-1369111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045165Biological Processcell fate commitment
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MSMKKEGEIL YKKGLWTMEE DKLLIDYVKV HGKGQWNKIA NRTGLKRSGK SCRLRWMNYL  60
GPNVKKGDFS EEEEDLIIRL HKLLGNRWSL IAKRVPGRTD NQVKNYWNSH LRKKLGIIDQ  120
NETRIDFCQS SKQVKVCHVD EAATDPSPGH GTTTETTGIT VDQSNQQEAI DHRVLNNTTQ  180
ESMTSESYIN TFWIPDHDYE LSTLAMIDHF HEYSSFHLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30131157108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO344519070.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT7515230.0KT751523.1 Gossypium hirsutum MYB109 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458020.11e-164PREDICTED: transcription factor WER
SwissprotQ9SEI09e-74WER_ARATH; Transcription factor WER
TrEMBLA0A0D2V2L31e-164A0A0D2V2L3_G
STRINGAT5G14750.12e-71(Arabidopsis thaliana)
STRINGfgenesh2_kg.6__1454__AT5G14750.12e-71(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-74myb domain protein 66